Lineage for d4dl0j2 (4dl0 J:98-224)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527763Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2527764Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2527765Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2527766Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310947] (3 PDB entries)
  8. 2527769Domain d4dl0j2: 4dl0 J:98-224 [307263]
    Other proteins in same PDB: d4dl0e1, d4dl0g_, d4dl0j1, d4dl0k_
    automated match to d3j9tg1
    complexed with pbm, so4

Details for d4dl0j2

PDB Entry: 4dl0 (more details), 2.91 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase
PDB Compounds: (J:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4dl0j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dl0j2 d.81.4.1 (J:98-224) V-type ATPase subunit E C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gifeetkeklsgiannrdeykpilqsliveallkllepkaivkalerdvdliesmkddim
reygekaqrapleeivisndylnkdlvsggvvvsnasdkieinntleerlkllseealpa
irlelyg

SCOPe Domain Coordinates for d4dl0j2:

Click to download the PDB-style file with coordinates for d4dl0j2.
(The format of our PDB-style files is described here.)

Timeline for d4dl0j2: