Lineage for d4dl0j1 (4dl0 J:2-97)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266875Superfamily h.1.36: V-type ATPase peripheral stalk subunit E coiled coil [310578] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 2266876Family h.1.36.1: V-type ATPase peripheral stalk subunit E coiled coil [310618] (1 protein)
  6. 2266877Protein V-type ATPase peripheral stalk subunit E coiled coil [310711] (2 species)
  7. 2266878Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310949] (3 PDB entries)
  8. 2266881Domain d4dl0j1: 4dl0 J:2-97 [307262]
    Other proteins in same PDB: d4dl0e2, d4dl0g_, d4dl0j2, d4dl0k_
    automated match to d3j9tg2
    complexed with pbm, so4

Details for d4dl0j1

PDB Entry: 4dl0 (more details), 2.9 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase
PDB Compounds: (J:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4dl0j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dl0j1 h.1.36.1 (J:2-97) V-type ATPase peripheral stalk subunit E coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
fksklkkamlsqqitkstiankmrlkvlsareqsld

SCOPe Domain Coordinates for d4dl0j1:

Click to download the PDB-style file with coordinates for d4dl0j1.
(The format of our PDB-style files is described here.)

Timeline for d4dl0j1: