| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) ![]() Unusual right-handed coiled coil noted in PubMed 20173764 |
| Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins) |
| Protein automated matches [310885] (1 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311372] (2 PDB entries) |
| Domain d4dl0g_: 4dl0 G: [307261] Other proteins in same PDB: d4dl0e1, d4dl0e2, d4dl0j1, d4dl0j2 automated match to d3j9th_ complexed with pbm, so4 |
PDB Entry: 4dl0 (more details), 2.91 Å
SCOPe Domain Sequences for d4dl0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dl0g_ h.1.37.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikps
Timeline for d4dl0g_: