Lineage for d4dl0g_ (4dl0 G:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040739Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 3040740Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)
  6. 3040749Protein automated matches [310885] (1 species)
    not a true protein
  7. 3040750Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311372] (2 PDB entries)
  8. 3040752Domain d4dl0g_: 4dl0 G: [307261]
    Other proteins in same PDB: d4dl0e1, d4dl0e2, d4dl0j1, d4dl0j2
    automated match to d3j9th_
    complexed with pbm, so4

Details for d4dl0g_

PDB Entry: 4dl0 (more details), 2.91 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase
PDB Compounds: (G:) V-type proton ATPase subunit G

SCOPe Domain Sequences for d4dl0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dl0g_ h.1.37.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikps

SCOPe Domain Coordinates for d4dl0g_:

Click to download the PDB-style file with coordinates for d4dl0g_.
(The format of our PDB-style files is described here.)

Timeline for d4dl0g_: