Lineage for d4dl0e2 (4dl0 E:98-224)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203758Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2203759Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2203760Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2203761Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310947] (3 PDB entries)
  8. 2203763Domain d4dl0e2: 4dl0 E:98-224 [307260]
    Other proteins in same PDB: d4dl0e1, d4dl0g_, d4dl0j1, d4dl0k_
    automated match to d3j9tg1
    complexed with pbm, so4

Details for d4dl0e2

PDB Entry: 4dl0 (more details), 2.9 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase
PDB Compounds: (E:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4dl0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dl0e2 d.81.4.1 (E:98-224) V-type ATPase subunit E C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gifeetkeklsgiannrdeykpilqsliveallkllepkaivkalerdvdliesmkddim
reygekaqrapleeivisndylnkdlvsggvvvsnasdkieinntleerlkllseealpa
irlelyg

SCOPe Domain Coordinates for d4dl0e2:

Click to download the PDB-style file with coordinates for d4dl0e2.
(The format of our PDB-style files is described here.)

Timeline for d4dl0e2: