SCOPe 2.08: Domain d4dl0e1: 4dl0 E:2-97

Lineage for d4dl0e1 (4dl0 E:2-97)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.36: V-type ATPase peripheral stalk subunit E coiled coil [310578] (1 family)
   Unusual right-handed coiled coil noted in PubMed 20173764

5. Family h.1.36.1: V-type ATPase peripheral stalk subunit E coiled coil [310618] (1 protein)

6. Protein V-type ATPase peripheral stalk subunit E coiled coil [310711] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310949] (3 PDB entries)

8. Domain d4dl0e1: 4dl0 E:2-97 [307259]
   Other proteins in same PDB: d4dl0e2, d4dl0g_, d4dl0j2, d4dl0k_
   automated match to d3j9tg2
   complexed with pbm, so4

Details for d4dl0e1

PDB Entry: 4dl0, 2.91 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase

PDB Compounds: (E:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4dl0e1:

Sequence; same for both SEQRES and ATOM records:

>d4dl0e1 h.1.36.1 (E:2-97) V-type ATPase peripheral stalk subunit E coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
fksklkkamlsqqitkstiankmrlkvlsareqsld

Timeline for d4dl0e1:

• d4dl0e1 first appeared in SCOPe 2.06
  
• d4dl0e1 appears in SCOPe 2.07