Lineage for d4dhxe_ (4dhx E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739463Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2739464Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2739465Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2739466Protein ENY2 [310815] (1 species)
  7. 2739467Species Human (Homo sapiens) [TaxId:9606] [311081] (1 PDB entry)
  8. 2739470Domain d4dhxe_: 4dhx E: [307257]
    Other proteins in same PDB: d4dhxa_, d4dhxd_
    protein/DNA complex; protein/RNA complex

Details for d4dhxe_

PDB Entry: 4dhx (more details), 2.1 Å

PDB Description: ENY2:GANP complex
PDB Compounds: (E:) Enhancer of yellow 2 transcription factor homolog

SCOPe Domain Sequences for d4dhxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhxe_ a.301.1.1 (E:) ENY2 {Human (Homo sapiens) [TaxId: 9606]}
daqmraainqklietgererlkellrakliecgwkdqlkahckevikekglehvtvddlv
aeitpkgralvpdsvkkellqrirtflaqhas

SCOPe Domain Coordinates for d4dhxe_:

Click to download the PDB-style file with coordinates for d4dhxe_.
(The format of our PDB-style files is described here.)

Timeline for d4dhxe_: