Lineage for d4dhxd_ (4dhx D:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047668Fold j.135: Sac3 CID region-like [310572] (1 superfamily)
  4. 3047669Superfamily j.135.1: Sac3 CID region-like [310604] (1 family) (S)
    interactions with Sus1, Cdc31 described in PubMed 19328066
  5. 3047670Family j.135.1.1: Sac3 CID region-like [310654] (2 proteins)
  6. 3047671Protein Germinal-centre associated nuclear protein (GANP) [310817] (1 species)
  7. 3047672Species Human (Homo sapiens) [TaxId:9606] [311083] (1 PDB entry)
    Pfam PF01745
  8. 3047674Domain d4dhxd_: 4dhx D: [307256]
    Other proteins in same PDB: d4dhxb_, d4dhxc_, d4dhxe_, d4dhxf_
    protein/DNA complex; protein/RNA complex

Details for d4dhxd_

PDB Entry: 4dhx (more details), 2.1 Å

PDB Description: ENY2:GANP complex
PDB Compounds: (D:) 80 kDa MCM3-associated protein

SCOPe Domain Sequences for d4dhxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhxd_ j.135.1.1 (D:) Germinal-centre associated nuclear protein (GANP) {Human (Homo sapiens) [TaxId: 9606]}
elsqglavelmervmmefvretcsqelknavetdqrvrvarccedvcahlvdlflveeif
qtaketlqe

SCOPe Domain Coordinates for d4dhxd_:

Click to download the PDB-style file with coordinates for d4dhxd_.
(The format of our PDB-style files is described here.)

Timeline for d4dhxd_: