SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4dhxc_ (4dhx C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017068Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2017069Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2017070Family a.301.1.1: Sus1-like [310653] (3 protein domains)
  6. 2017071Protein ENY2 [310815] (1 species)
  7. 2017072Species Human (Homo sapiens) [TaxId:9606] [311081] (1 PDB entry)
  8. 2017074Domain d4dhxc_: 4dhx C: [307255]
    Other proteins in same PDB: d4dhxa_, d4dhxd_
    protein/DNA complex; protein/RNA complex

Details for d4dhxc_

PDB Entry: 4dhx (more details), 2.1 Å

PDB Description: ENY2:GANP complex
PDB Compounds: (C:) Enhancer of yellow 2 transcription factor homolog

SCOPe Domain Sequences for d4dhxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhxc_ a.301.1.1 (C:) ENY2 {Human (Homo sapiens) [TaxId: 9606]}
nkdaqmraainqklietgererlkellrakliecgwkdqlkahckevikekglehvtvdd
lvaeitpkgralvpdsvkkellqrirtflaqha

SCOPe Domain Coordinates for d4dhxc_:

Click to download the PDB-style file with coordinates for d4dhxc_.
(The format of our PDB-style files is described here.)

Timeline for d4dhxc_:

  • d4dhxc_ is new in SCOPe 2.06-stable