Lineage for d4ddeb_ (4dde B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833158Species Streptococcus mutans [TaxId:1309] [195139] (3 PDB entries)
  8. 2833160Domain d4ddeb_: 4dde B: [307251]
    Other proteins in same PDB: d4ddea2
    automated match to d4f66a_
    complexed with bg6, edo

Details for d4ddeb_

PDB Entry: 4dde (more details), 1.45 Å

PDB Description: The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate.
PDB Compounds: (B:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d4ddeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ddeb_ c.1.8.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
msklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypnh
eaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclky
giepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinnq
anyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmvam
cpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkdl
fegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglryal
nwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmgy
tpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi

SCOPe Domain Coordinates for d4ddeb_:

Click to download the PDB-style file with coordinates for d4ddeb_.
(The format of our PDB-style files is described here.)

Timeline for d4ddeb_: