Lineage for d4d7ta_ (4d7t A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071306Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2071539Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2071540Protein automated matches [226927] (14 species)
    not a true protein
  7. 2071593Species Spirochaeta thermophila [TaxId:665571] [311368] (2 PDB entries)
  8. 2071596Domain d4d7ta_: 4d7t A: [307244]
    automated match to d2ptma_
    complexed with cmp

Details for d4d7ta_

PDB Entry: 4d7t (more details), 2.58 Å

PDB Description: structure of the sthk carboxy-terminal region in complex with camp
PDB Compounds: (A:) sthk_cnbd_camp

SCOPe Domain Sequences for d4d7ta_:

Sequence, based on SEQRES records: (download)

>d4d7ta_ b.82.3.0 (A:) automated matches {Spirochaeta thermophila [TaxId: 665571]}
daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
eiaaqiqelavrrkeele

Sequence, based on observed residues (ATOM records): (download)

>d4d7ta_ b.82.3.0 (A:) automated matches {Spirochaeta thermophila [TaxId: 665571]}
daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
eaaqiqelavrrkeele

SCOPe Domain Coordinates for d4d7ta_:

Click to download the PDB-style file with coordinates for d4d7ta_.
(The format of our PDB-style files is described here.)

Timeline for d4d7ta_:

  • d4d7ta_ is new in SCOPe 2.06-stable