![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (14 species) not a true protein |
![]() | Species Spirochaeta thermophila [TaxId:665571] [311368] (2 PDB entries) |
![]() | Domain d4d7sa_: 4d7s A: [307242] automated match to d2ptma_ complexed with pcg |
PDB Entry: 4d7s (more details), 2.55 Å
SCOPe Domain Sequences for d4d7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d7sa_ b.82.3.0 (A:) automated matches {Spirochaeta thermophila [TaxId: 665571]} daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp eiaaqiqelavrrkeel
Timeline for d4d7sa_: