![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
![]() | Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
![]() | Protein Aconitase A, C-terminal domain [52018] (2 species) other three domains have alpha/beta folds |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52020] (9 PDB entries) |
![]() | Domain d8acna1: 8acn A:529-754 [30724] Other proteins in same PDB: d8acna2 complexed with nic, sf4 |
PDB Entry: 8acn (more details), 2 Å
SCOPe Domain Sequences for d8acna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8acna1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn nlligainsenrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsa leprflggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg kpltciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk
Timeline for d8acna1: