Lineage for d4d72a2 (4d72 A:839-1003)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049300Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2049357Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) (S)
    C-terminal half of Pfam PF08307
    Slightly different topology from Hyaluronate lyase; contains helical insert
  5. 2049362Family b.24.2.0: automated matches [310667] (1 protein)
    not a true family
  6. 2049363Protein automated matches [310861] (2 species)
    not a true protein
  7. 2049367Species Streptococcus pneumoniae [TaxId:406556] [311249] (13 PDB entries)
  8. 2049383Domain d4d72a2: 4d72 A:839-1003 [307237]
    Other proteins in same PDB: d4d72a1, d4d72a3
    automated match to d2wmfa2
    complexed with a2g, edo; mutant

Details for d4d72a2

PDB Entry: 4d72 (more details), 2.11 Å

PDB Description: crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 2 blood group a-tetrasaccharide (e558a l19 mutant)
PDB Compounds: (A:) glycoside hydrolase

SCOPe Domain Sequences for d4d72a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d72a2 b.24.2.0 (A:839-1003) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
yegdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvn
lnnfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgid
klptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhf

SCOPe Domain Coordinates for d4d72a2:

Click to download the PDB-style file with coordinates for d4d72a2.
(The format of our PDB-style files is described here.)

Timeline for d4d72a2: