SCOPe 2.05: Domain d1acoa1: 1aco A:529-754

Lineage for d1acoa1 (1aco A:529-754)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
   Pfam PF00694; permutation of the domain order in the proteins containing this family domain

6. Protein Aconitase A, C-terminal domain [52018] (2 species)
   other three domains have alpha/beta folds

7. Species Cow (Bos taurus) [TaxId:9913] [52020] (9 PDB entries)

8. Domain d1acoa1: 1aco A:529-754 [30723]
   Other proteins in same PDB: d1acoa2
   complexed with sf4, tra

Details for d1acoa1

PDB Entry: 1aco, 2.05 Å

PDB Description: crystal structure of aconitase with transaconitate bound

PDB Compounds: (A:) aconitase

SCOPe Domain Sequences for d1acoa1:

Sequence; same for both SEQRES and ATOM records:

>d1acoa1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainsenrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsa
leprflggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kpltciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

Timeline for d1acoa1:

• d1acoa1 first appeared (with stable ids) in SCOP 1.55, called d1aco_1
  
• d1acoa1 appears in SCOPe 2.04
  
• d1acoa1 appears in SCOPe 2.06
  
• d1acoa1 appears in the current release, SCOPe 2.08