Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) contains mixed beta-sheet barrel, closed n=7, S=10 |
Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
Protein Aconitase A, C-terminal domain [52018] (2 species) other three domains have alpha/beta folds |
Species Cow (Bos taurus) [TaxId:9913] [52020] (9 PDB entries) |
Domain d1acoa1: 1aco A:529-754 [30723] Other proteins in same PDB: d1acoa2 complexed with sf4, tra |
PDB Entry: 1aco (more details), 2.05 Å
SCOPe Domain Sequences for d1acoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acoa1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn nlligainsenrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsa leprflggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg kpltciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk
Timeline for d1acoa1: