| Class b: All beta proteins [48724] (180 folds) |
| Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) ![]() C-terminal half of Pfam PF08307 Slightly different topology from Hyaluronate lyase; contains helical insert |
| Family b.24.2.0: automated matches [310667] (1 protein) not a true family |
| Protein automated matches [310861] (2 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:406556] [311249] (13 PDB entries) |
| Domain d4d6ga2: 4d6g A:839-1003 [307222] Other proteins in same PDB: d4d6ga1, d4d6ga3 automated match to d2wmfa2 complexed with edo; mutant |
PDB Entry: 4d6g (more details), 1.24 Å
SCOPe Domain Sequences for d4d6ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d6ga2 b.24.2.0 (A:839-1003) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
yegdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvn
lnnfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgid
klptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhf
Timeline for d4d6ga2: