![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
![]() | Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
![]() | Protein Aconitase A, C-terminal domain [52018] (2 species) other three domains have alpha/beta folds |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries) |
![]() | Domain d1b0ma1: 1b0m A:529-754 [30722] Other proteins in same PDB: d1b0ma2 complexed with flc, sf4 |
PDB Entry: 1b0m (more details), 2.5 Å
SCOPe Domain Sequences for d1b0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0ma1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssqehsa leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk
Timeline for d1b0ma1: