Lineage for d1b0ma1 (1b0m A:529-754)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67590Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 67613Superfamily c.8.2: Aconitase, C-terminal domain [52016] (1 family) (S)
  5. 67614Family c.8.2.1: Aconitase, C-terminal domain [52017] (1 protein)
  6. 67615Protein Aconitase, C-terminal domain [52018] (2 species)
  7. 67626Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries)
  8. 67632Domain d1b0ma1: 1b0m A:529-754 [30722]
    Other proteins in same PDB: d1b0ma2

Details for d1b0ma1

PDB Entry: 1b0m (more details), 2.5 Å

PDB Description: aconitase r644q:fluorocitrate complex

SCOP Domain Sequences for d1b0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ma1 c.8.2.1 (A:529-754) Aconitase, C-terminal domain {Pig (Sus scrofa)}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssqehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

SCOP Domain Coordinates for d1b0ma1:

Click to download the PDB-style file with coordinates for d1b0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1b0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ma2