Lineage for d1b0ma1 (1b0m A:529-754)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) 
Superfamily c.8.2: Aconitase, C-terminal domain [52016] (1 family) 
Family c.8.2.1: Aconitase, C-terminal domain [52017] (1 protein) Protein Aconitase, C-terminal domain [52018] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries) 
Domain d1b0ma1: 1b0m A:529-754 [30722]
Other proteins in same PDB: d1b0ma2
Details for d1b0ma1
PDB Entry: 1b0m (more details), 2.5 Å
PDB Description: aconitase r644q:fluorocitrate complex
SCOP Domain Sequences for d1b0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0ma1 c.8.2.1 (A:529-754) Aconitase, C-terminal domain {Pig (Sus scrofa)}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssqehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk
SCOP Domain Coordinates for d1b0ma1:
Click to download the PDB-style file with coordinates for d1b0ma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0ma1:
- d1b0ma1 appears in SCOP 1.57
- d1b0ma1 appears in the current release, SCOPe 2.08
View in 3D
