Lineage for d4d6ea2 (4d6e A:839-1003)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777794Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2777851Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) (S)
    C-terminal half of Pfam PF08307
    Slightly different topology from Hyaluronate lyase; contains helical insert
  5. 2777856Family b.24.2.0: automated matches [310667] (1 protein)
    not a true family
  6. 2777857Protein automated matches [310861] (2 species)
    not a true protein
  7. 2777861Species Streptococcus pneumoniae [TaxId:406556] [311249] (13 PDB entries)
  8. 2777863Domain d4d6ea2: 4d6e A:839-1003 [307216]
    Other proteins in same PDB: d4d6ea1, d4d6ea3
    automated match to d2wmfa2
    complexed with edo, so4; mutant

Details for d4d6ea2

PDB Entry: 4d6e (more details), 1.45 Å

PDB Description: crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (x01 mutant)
PDB Compounds: (A:) glycoside hydrolase

SCOPe Domain Sequences for d4d6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6ea2 b.24.2.0 (A:839-1003) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
yegdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvn
lnnfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgid
klptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhf

SCOPe Domain Coordinates for d4d6ea2:

Click to download the PDB-style file with coordinates for d4d6ea2.
(The format of our PDB-style files is described here.)

Timeline for d4d6ea2: