Lineage for d4d3ta_ (4d3t A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236062Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2236063Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2236064Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2236862Protein automated matches [190421] (6 species)
    not a true protein
  7. 2236868Species Bacillus subtilis [TaxId:224308] [228529] (68 PDB entries)
  8. 2236869Domain d4d3ta_: 4d3t A: [307191]
    automated match to d4ugwa_
    complexed with cl, gol, hem, pol, rfq

Details for d4d3ta_

PDB Entry: 4d3t (more details), 1.55 Å

PDB Description: structure of bacillus subtilis nitric oxide synthase in complex with n-{3-[(1s)-2-(3-{(z)-[amino(thiophen-2-yl)methylidene]amino}phenoxy)- 1-hydroxyethyl]phenyl}thiophene-2-carboximidamide
PDB Compounds: (A:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d4d3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d3ta_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

SCOPe Domain Coordinates for d4d3ta_:

Click to download the PDB-style file with coordinates for d4d3ta_.
(The format of our PDB-style files is described here.)

Timeline for d4d3ta_: