Lineage for d1b0ja1 (1b0j A:529-754)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459236Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2459284Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 2459285Family c.8.2.1: LeuD-like [52017] (4 proteins)
    Pfam PF00694; permutation of the domain order in the proteins containing this family domain
  6. 2459286Protein Aconitase A, C-terminal domain [52018] (2 species)
    other three domains have alpha/beta folds
  7. 2459297Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries)
  8. 2459298Domain d1b0ja1: 1b0j A:529-754 [30719]
    Other proteins in same PDB: d1b0ja2
    complexed with ict, sf4

Details for d1b0ja1

PDB Entry: 1b0j (more details), 2.5 Å

PDB Description: crystal structure of aconitase with isocitrate
PDB Compounds: (A:) aconitate hydratase

SCOPe Domain Sequences for d1b0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ja1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

SCOPe Domain Coordinates for d1b0ja1:

Click to download the PDB-style file with coordinates for d1b0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1b0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ja2