SCOPe 2.07: Domain d1b0ja1: 1b0j A:529-754

Lineage for d1b0ja1 (1b0j A:529-754)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
   Pfam PF00694; permutation of the domain order in the proteins containing this family domain

6. Protein Aconitase A, C-terminal domain [52018] (2 species)
   other three domains have alpha/beta folds

7. Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries)

8. Domain d1b0ja1: 1b0j A:529-754 [30719]
   Other proteins in same PDB: d1b0ja2
   complexed with ict, sf4

Details for d1b0ja1

PDB Entry: 1b0j, 2.5 Å

PDB Description: crystal structure of aconitase with isocitrate

PDB Compounds: (A:) aconitate hydratase

SCOPe Domain Sequences for d1b0ja1:

Sequence; same for both SEQRES and ATOM records:

>d1b0ja1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

Timeline for d1b0ja1:

• d1b0ja1 first appeared (with stable ids) in SCOP 1.55
  
• d1b0ja1 appears in SCOPe 2.06
  
• d1b0ja1 appears in the current release, SCOPe 2.08