SCOPe 2.07: Domain d4d3kb_: 4d3k B:

Lineage for d4d3kb_ (4d3k B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228529] (75 PDB entries)

8. Domain d4d3kb_: 4d3k B: [307189]
   automated match to d4ugwa_
   complexed with 12s, cl, gol, hem, peg

Details for d4d3kb_

PDB Entry: 4d3k, 2.02 Å

PDB Description: Structure of Bacillus subtilis nitric oxide synthase in complex with 6,6'-((5-(3-aminopropyl)-1,3-phenylene)bis(ethane-2,1-diyl))bis(4- methylpyridin-2-amine)

PDB Compounds: (B:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d4d3kb_:

Sequence; same for both SEQRES and ATOM records:

>d4d3kb_ d.174.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

Timeline for d4d3kb_:

• d4d3kb_ first appeared in SCOPe 2.06
  
• d4d3kb_ appears in the current release, SCOPe 2.08