Lineage for d7acn_1 (7acn 529-754)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) 
Superfamily c.8.2: Aconitase, C-terminal domain [52016] (1 family) 
Family c.8.2.1: Aconitase, C-terminal domain [52017] (1 protein) Protein Aconitase, C-terminal domain [52018] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [52019] (6 PDB entries) 
Domain d7acn_1: 7acn 529-754 [30717]
Other proteins in same PDB: d7acn_2
Details for d7acn_1
PDB Entry: 7acn (more details), 2 Å
PDB Description: crystal structures of aconitase with isocitrate and nitroisocitrate bound
SCOP Domain Sequences for d7acn_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7acn_1 c.8.2.1 (529-754) Aconitase, C-terminal domain {Pig (Sus scrofa)}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk
SCOP Domain Coordinates for d7acn_1:
Click to download the PDB-style file with coordinates for d7acn_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7acn_1:
- d7acn_1 appears in SCOP 1.57
- d7acn_1 appears in the current release, SCOPe 2.08, called d7acna1
View in 3D
