SCOPe 2.07: Domain d4cteb_: 4cte B:

Lineage for d4cteb_ (4cte B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [224860] (7 PDB entries)

8. Domain d4cteb_: 4cte B: [307167]
   automated match to d3azza_
   complexed with act, ca, cl, edo, gol, gs1, na; mutant

Details for d4cteb_

PDB Entry: 4cte, 1.8 Å

PDB Description: crystal structure of the catalytic domain of the modular laminarinase zglamc mutant e142s in complex with a thio-oligosaccharide

PDB Compounds: (B:) endo-1,3-beta-glucanase, family gh16

SCOPe Domain Sequences for d4cteb_:

Sequence; same for both SEQRES and ATOM records:

>d4cteb_ b.29.1.0 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
dynlvwqdefddgigpdwvfetgmgyngwgnnelqyyrrenaavengnlvitakhenfgg
aqytsarmktqgrksfkygkiearialpsgqglwpafwmlgnnitsvswpacgeidimsr
innalqthgtihwsdqngdhasygddvgvsdpgqyhiysvewdansikwfvdgqqfnevd
isngvngtgefqneffillnmavggdwpgfdvdqsklpaqmlvdyvrvyqk

Timeline for d4cteb_:

• d4cteb_ first appeared in SCOPe 2.06
  
• d4cteb_ appears in the current release, SCOPe 2.08