Lineage for d4crqb_ (4crq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781460Species Zobellia galactanivorans [TaxId:63186] [224860] (7 PDB entries)
  8. 2781469Domain d4crqb_: 4crq B: [307165]
    automated match to d3azza_
    complexed with act, ca, cl, edo, mg, na; mutant

Details for d4crqb_

PDB Entry: 4crq (more details), 1.5 Å

PDB Description: crystal structure of the catalytic domain of the modular laminarinase zglamc mutant e142s
PDB Compounds: (B:) endo-1,3-beta-glucanase, family gh16

SCOPe Domain Sequences for d4crqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crqb_ b.29.1.0 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
dynlvwqdefddgigpdwvfetgmgyngwgnnelqyyrrenaavengnlvitakhenfgg
aqytsarmktqgrksfkygkiearialpsgqglwpafwmlgnnitsvswpacgeidimsr
innalqthgtihwsdqngdhasygddvgvsdpgqyhiysvewdansikwfvdgqqfnevd
isngvngtgefqneffillnmavggdwpgfdvdqsklpaqmlvdyvrvyqk

SCOPe Domain Coordinates for d4crqb_:

Click to download the PDB-style file with coordinates for d4crqb_.
(The format of our PDB-style files is described here.)

Timeline for d4crqb_: