Lineage for d4crpa1 (4crp A:3-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754027Domain d4crpa1: 4crp A:3-107 [307162]
    Other proteins in same PDB: d4crpa2
    automated match to d1wwax_

Details for d4crpa1

PDB Entry: 4crp (more details)

PDB Description: solution structure of a trkaig2 domain construct for use in drug discovery
PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d4crpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crpa1 b.1.1.4 (A:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dddvsfcasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaan
etvrhgclrlnqpthvnngnytllaanpcgqasasimaafmdnpf

SCOPe Domain Coordinates for d4crpa1:

Click to download the PDB-style file with coordinates for d4crpa1.
(The format of our PDB-style files is described here.)

Timeline for d4crpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4crpa2