SCOPe 2.04: Domain d3ezea2: 3eze A:1-21,A:145-249

Lineage for d3ezea2 (3eze A:1-21,A:145-249)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
   contains 4-helical insert domain, residues 22-144

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d3ezea2: 3eze A:1-21,A:145-249 [30716]
   Other proteins in same PDB: d3ezea1, d3ezeb_
   complexed with po3

Details for d3ezea2

PDB Entry: 3eze

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

PDB Compounds: (A:) protein (phosphotransferase system, enzyme I)

SCOPe Domain Sequences for d3ezea2:

Sequence; same for both SEQRES and ATOM records:

>d3ezea2 c.8.1.2 (A:1-21,A:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvase

Timeline for d3ezea2:

• d3ezea2 first appeared (with stable ids) in SCOP 1.55
  
• d3ezea2 appears in SCOPe 2.03
  
• d3ezea2 appears in SCOPe 2.05
  
• d3ezea2 appears in the current release, SCOPe 2.08