![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) ![]() contains barrel, closed, n=7, S=10 |
![]() | Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein) |
![]() | Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species) contains 4-helical insert domain, residues 22-144 |
![]() | Species Escherichia coli [TaxId:562] [52015] (11 PDB entries) |
![]() | Domain d3ezea2: 3eze A:1-21,A:145-249 [30716] Other proteins in same PDB: d3ezea1, d3ezeb_ complexed with po3 |
PDB Entry: 3eze (more details)
SCOPe Domain Sequences for d3ezea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezea2 c.8.1.2 (A:1-21,A:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]} misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav qeqvase
Timeline for d3ezea2: