Lineage for d4crfa_ (4crf A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388211Protein Coagulation factor XI [117237] (1 species)
  7. 2388212Species Human (Homo sapiens) [TaxId:9606] [117238] (48 PDB entries)
    Uniprot P03951 388-624
  8. 2388247Domain d4crfa_: 4crf A: [307158]
    automated match to d1zhra_
    complexed with ala, cl, gol, r9b, so4

Details for d4crfa_

PDB Entry: 4crf (more details), 2.3 Å

PDB Description: creating novel f1 inhibitors through fragment based lead generation and structure aided drug design
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d4crfa_:

Sequence, based on SEQRES records: (download)

>d4crfa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

Sequence, based on observed residues (ATOM records): (download)

>d4crfa_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdrn
viytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyreggk
dackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d4crfa_:

Click to download the PDB-style file with coordinates for d4crfa_.
(The format of our PDB-style files is described here.)

Timeline for d4crfa_: