Lineage for d4crea_ (4cre A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2388211Protein Coagulation factor XI [117237] (1 species)
  7. 2388212Species Human (Homo sapiens) [TaxId:9606] [117238] (46 PDB entries)
    Uniprot P03951 388-624
  8. 2388221Domain d4crea_: 4cre A: [307157]
    automated match to d1zhra_
    complexed with mvn, so4

Details for d4crea_

PDB Entry: 4cre (more details), 1.73 Å

PDB Description: creating novel f1 inhibitors through fragment based lead generation and structure aided drug design
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d4crea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crea_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskger
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d4crea_:

Click to download the PDB-style file with coordinates for d4crea_.
(The format of our PDB-style files is described here.)

Timeline for d4crea_: