| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.8: Putative cyclase [102198] (2 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
| Family c.8.8.0: automated matches [238093] (1 protein) not a true family |
| Protein automated matches [238095] (3 species) not a true protein |
| Species Bacillus anthracis [TaxId:198094] [256229] (3 PDB entries) |
| Domain d4coab_: 4coa B: [307149] automated match to d4co9a_ complexed with mg, vnj, zn |
PDB Entry: 4coa (more details), 2.25 Å
SCOPe Domain Sequences for d4coab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4coab_ c.8.8.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
dyelialplalsdadgspvravirpi
Timeline for d4coab_: