SCOPe 2.06: Domain d4ckog3: 4cko G:337-444

Lineage for d4ckog3 (4cko G:337-444)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d4ckog3: 4cko G:337-444 [307140]
   Other proteins in same PDB: d4ckoa3, d4ckob4, d4ckoc4, d4ckod4, d4ckoe4, d4ckof4, d4ckog4, d4ckoh4
   automated match to d1qm9a1
   complexed with cl, zn

Details for d4ckog3

PDB Entry: 4cko, 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB

PDB Compounds: (G:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckog3:

Sequence, based on SEQRES records:

>d4ckog3 d.58.7.1 (G:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs

Sequence, based on observed residues (ATOM records):

>d4ckog3 d.58.7.1 (G:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlprdqgltkdfgnsplhrfkkpgs

Timeline for d4ckog3:

• d4ckog3 is new in SCOPe 2.06-stable
  
• d4ckog3 appears in SCOPe 2.07
  
• d4ckog3 appears in the current release, SCOPe 2.08