![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
![]() | Domain d4ckof4: 4cko F:445-531 [307139] Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3 automated match to d2adca2 complexed with cl, zn |
PDB Entry: 4cko (more details), 1.69 Å
SCOPe Domain Sequences for d4ckof4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ckof4 d.58.7.0 (F:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]} knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea iqalidlhnynlgenhhlrvsfsksti
Timeline for d4ckof4: