Lineage for d4ckoe4 (4cko E:445-531)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952534Domain d4ckoe4: 4cko E:445-531 [307137]
    Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3
    automated match to d2adca2
    complexed with cl, zn

Details for d4ckoe4

PDB Entry: 4cko (more details), 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB
PDB Compounds: (E:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckoe4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ckoe4 d.58.7.0 (E:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

SCOPe Domain Coordinates for d4ckoe4:

Click to download the PDB-style file with coordinates for d4ckoe4.
(The format of our PDB-style files is described here.)

Timeline for d4ckoe4: