Lineage for d4ckoc4 (4cko C:445-531)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559396Domain d4ckoc4: 4cko C:445-531 [307133]
    Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3
    automated match to d2adca2
    complexed with cl, zn

Details for d4ckoc4

PDB Entry: 4cko (more details), 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB
PDB Compounds: (C:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckoc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ckoc4 d.58.7.0 (C:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

SCOPe Domain Coordinates for d4ckoc4:

Click to download the PDB-style file with coordinates for d4ckoc4.
(The format of our PDB-style files is described here.)

Timeline for d4ckoc4: