Lineage for d4ckoc3 (4cko C:337-444)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195519Domain d4ckoc3: 4cko C:337-444 [307132]
    Other proteins in same PDB: d4ckoa3, d4ckob4, d4ckoc4, d4ckod4, d4ckoe4, d4ckof4, d4ckog4, d4ckoh4
    automated match to d1qm9a1
    complexed with cl, zn

Details for d4ckoc3

PDB Entry: 4cko (more details), 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB
PDB Compounds: (C:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckoc3:

Sequence, based on SEQRES records: (download)

>d4ckoc3 d.58.7.1 (C:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs

Sequence, based on observed residues (ATOM records): (download)

>d4ckoc3 d.58.7.1 (C:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpgltkdfgnsplhrfkkpgs

SCOPe Domain Coordinates for d4ckoc3:

Click to download the PDB-style file with coordinates for d4ckoc3.
(The format of our PDB-style files is described here.)

Timeline for d4ckoc3: