| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries) |
| Domain d4ckob4: 4cko B:445-531 [307131] Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3 automated match to d2adca2 complexed with cl, zn |
PDB Entry: 4cko (more details), 1.69 Å
SCOPe Domain Sequences for d4ckob4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ckob4 d.58.7.0 (B:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti
Timeline for d4ckob4: