Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries) |
Domain d4ckoa3: 4cko A:445-531 [307129] Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3 automated match to d2adca2 complexed with cl, zn |
PDB Entry: 4cko (more details), 1.69 Å
SCOPe Domain Sequences for d4ckoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ckoa3 d.58.7.0 (A:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]} knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea iqalidlhnynlgenhhlrvsfsksti
Timeline for d4ckoa3: