SCOPe 2.06: Domain d4ckoa3: 4cko A:445-531

Lineage for d4ckoa3 (4cko A:445-531)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d4ckoa3: 4cko A:445-531 [307129]
   Other proteins in same PDB: d4ckoa2, d4ckob3, d4ckoc3, d4ckod3, d4ckoe3, d4ckof3, d4ckog3, d4ckoh3
   automated match to d2adca2
   complexed with cl, zn

Details for d4ckoa3

PDB Entry: 4cko, 1.69 Å

PDB Description: Crystal structure of the neuronal isoform of PTB

PDB Compounds: (A:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4ckoa3:

Sequence; same for both SEQRES and ATOM records:

>d4ckoa3 d.58.7.0 (A:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

Timeline for d4ckoa3:

• d4ckoa3 is new in SCOPe 2.06-stable
  
• d4ckoa3 appears in SCOPe 2.07
  
• d4ckoa3 appears in the current release, SCOPe 2.08