SCOPe 2.08: Domain d4cjya2: 4cjy A:158-260

Lineage for d4cjya2 (4cjy A:158-260)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d4cjya2: 4cjy A:158-260 [307120]
   Other proteins in same PDB: d4cjyc_, d4cjyd_
   automated match to d2i53a2

Details for d4cjya2

PDB Entry: 4cjy, 3.15 Å

PDB Description: Crystal structure of the human CDK12-cyclinK complex

PDB Compounds: (A:) cyclin-k

SCOPe Domain Sequences for d4cjya2:

Sequence; same for both SEQRES and ATOM records:

>d4cjya2 a.74.1.1 (A:158-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysq

Timeline for d4cjya2:

• d4cjya2 first appeared in SCOPe 2.06
  
• d4cjya2 appears in SCOPe 2.07