SCOPe 2.05: Domain d1ezba2: 1ezb A:1-21,A:145-259

Lineage for d1ezba2 (1ezb A:1-21,A:145-259)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
   contains 4-helical insert domain, residues 22-144

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d1ezba2: 1ezb A:1-21,A:145-259 [30712]
   Other proteins in same PDB: d1ezba1

Details for d1ezba2

PDB Entry: 1ezb

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 17 structures

PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1ezba2:

Sequence; same for both SEQRES and ATOM records:

>d1ezba2 c.8.1.2 (A:1-21,A:145-259) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvasekaelaklkdr

Timeline for d1ezba2:

• d1ezba2 first appeared (with stable ids) in SCOP 1.55, called d1ezb_2
  
• d1ezba2 appears in SCOPe 2.04
  
• d1ezba2 appears in SCOPe 2.06
  
• d1ezba2 appears in the current release, SCOPe 2.08