SCOPe 2.06: Domain d4cjxa1: 4cjx A:1-124

Lineage for d4cjxa1 (4cjx A:1-124)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (29 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [311366] (1 PDB entry)

8. Domain d4cjxa1: 4cjx A:1-124 [307115]
   Other proteins in same PDB: d4cjxa2, d4cjxb2
   automated match to d4a26b1
   complexed with 9l9, gol, nap, peg

Details for d4cjxa1

PDB Entry: 4cjx, 2.05 Å

PDB Description: the crystal structure of trypanosoma brucei n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor

PDB Compounds: (A:) c-1-tetrahydrofolate synthase, cytoplasmic, putative

SCOPe Domain Sequences for d4cjxa1:

Sequence; same for both SEQRES and ATOM records:

>d4cjxa1 c.58.1.0 (A:1-124) automated matches {Trypanosoma brucei [TaxId: 999953]}
mpeavvidgravakaiqkelteevallerrykgrrpglstiicgkrkdsqtyvrlkrkaa
aacgfrnfsvelpanvtqealerevirlneeeachsivvqlplpphidkvaalskikpek
dadc

Timeline for d4cjxa1:

• d4cjxa1 is new in SCOPe 2.06-stable
  
• d4cjxa1 appears in SCOPe 2.07
  
• d4cjxa1 appears in the current release, SCOPe 2.08