Lineage for d4ce0a_ (4ce0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130545Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 protein domains)
    Pfam PF05711
  6. 2130579Protein automated matches [310884] (2 species)
    not a true protein
  7. 2130606Species Saccharopolyspora spinosa [TaxId:60894] [311365] (1 PDB entry)
  8. 2130607Domain d4ce0a_: 4ce0 A: [307111]
    automated match to d2wk1a_
    complexed with mg, sah

Details for d4ce0a_

PDB Entry: 4ce0 (more details), 2 Å

PDB Description: Crystal Structure of SAH-bound Spinosyn Rhamnosyl 4'-O- Methyltransferase SpnH from Saccharopolyspora spinosa
PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d4ce0a_:

Sequence, based on SEQRES records: (download)

>d4ce0a_ c.66.1.61 (A:) automated matches {Saccharopolyspora spinosa [TaxId: 60894]}
psqnalyldllkkvltntiysdrphpnawqdntdyrqaarakgtdwptvahtmiglerld
nlqhcveavladgvpgdfaetgvwrggacifmravlqafgdtgrtvwvvdsfqgmpessa
qdhqadqamalheyndvlgvsletvrqnfaryglldeqvrflpgwfrdtlptapiqelav
lrldgdlyestmdslrnlypklspggfviiddyflpscqdavkgfraelgitepihdidg
tgaywrrs

Sequence, based on observed residues (ATOM records): (download)

>d4ce0a_ c.66.1.61 (A:) automated matches {Saccharopolyspora spinosa [TaxId: 60894]}
psqnalyldllkkvltntiywptvahtmiglerldnlqhcveavladgvpgdfaetgvwr
ggacifmravlqafgdtgrtvwvvdsfqgmpeamalheyndvlgvsletvrqnfarygll
deqvrflpgwfrdtlptapiqelavlrldgdlyestmdslrnlypklspggfviiddyfl
pscqdavkgfraelgitepihdidgtgaywrrs

SCOPe Domain Coordinates for d4ce0a_:

Click to download the PDB-style file with coordinates for d4ce0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ce0a_:

  • d4ce0a_ is new in SCOPe 2.06-stable