SCOP 1.59: Domain d2eza_2: 2eza 1-21,145-259

Lineage for d2eza_2 (2eza 1-21,145-259)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d2eza_2: 2eza 1-21,145-259 [30711]
   Other proteins in same PDB: d2eza_1

Details for d2eza_2

PDB Entry: 2eza

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, restrained regularized mean structure

SCOP Domain Sequences for d2eza_2:

Sequence; same for both SEQRES and ATOM records:

>d2eza_2 c.8.1.2 (1-21,145-259) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvasekaelaklkdr

Timeline for d2eza_2:

• d2eza_2 first appeared (with stable ids) in SCOP 1.55
  
• d2eza_2 appears in SCOP 1.57
  
• d2eza_2 appears in SCOP 1.61
  
• d2eza_2 appears in the current release, SCOPe 2.08, called d2ezaa2