Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins) automatically mapped to Pfam PF02668 |
Protein Gamma-butyrobetaine dioxygenase (BBOX1) catalytic domain [310813] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [311079] (4 PDB entries) |
Domain d4c8re2: 4c8r E:96-384 [307103] Other proteins in same PDB: d4c8ra1, d4c8rb1, d4c8rc1, d4c8rd1, d4c8re1, d4c8rf1 automated match to d3ms5a2 complexed with 6yt, edo, ni, zn |
PDB Entry: 4c8r (more details), 2.82 Å
SCOPe Domain Sequences for d4c8re2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c8re2 b.82.2.5 (E:96-384) Gamma-butyrobetaine dioxygenase (BBOX1) catalytic domain {Human (Homo sapiens) [TaxId: 9606]} fskqaraklqrelffpecqywgselqlptldfedvlrydehaykwlstlkkvgivrltga sdkpgevsklgkrmgflyltfyghtwqvqdkidannvayttgklsfhtdypalhhppgvq llhcikqtvtggdseivdgfnvcqklkknnpqafqilsstfvdftdigvdycdfsvqskh kiielddkgqvvrinfnnatrdtifdvpvervqpfyaalkefvdlmnskeskftfkmnpg dvitfdnwrllhgrrsyeagteisrhlegayadwdvvmsrlrilrqrve
Timeline for d4c8re2: