SCOPe 2.08: Domain d4c8re2: 4c8r E:96-384

Lineage for d4c8re2 (4c8r E:96-384)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
   automatically mapped to Pfam PF02668

6. Protein Gamma-butyrobetaine dioxygenase (BBOX1) catalytic domain [310813] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311079] (4 PDB entries)

8. Domain d4c8re2: 4c8r E:96-384 [307103]
   Other proteins in same PDB: d4c8ra1, d4c8rb1, d4c8rc1, d4c8rd1, d4c8re1, d4c8rf1
   automated match to d3ms5a2
   complexed with 6yt, edo, ni, zn

Details for d4c8re2

PDB Entry: 4c8r, 2.82 Å

PDB Description: human gamma-butyrobetaine dioxygenase (bbox1) in complex with ni(ii) and n-(3-hydroxypicolinoyl)-s-(pyridin-2-ylmethyl)-l-cysteine (ar692b)

PDB Compounds: (E:) Gamma-butyrobetaine dioxygenase

SCOPe Domain Sequences for d4c8re2:

Sequence; same for both SEQRES and ATOM records:

>d4c8re2 b.82.2.5 (E:96-384) Gamma-butyrobetaine dioxygenase (BBOX1) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fskqaraklqrelffpecqywgselqlptldfedvlrydehaykwlstlkkvgivrltga
sdkpgevsklgkrmgflyltfyghtwqvqdkidannvayttgklsfhtdypalhhppgvq
llhcikqtvtggdseivdgfnvcqklkknnpqafqilsstfvdftdigvdycdfsvqskh
kiielddkgqvvrinfnnatrdtifdvpvervqpfyaalkefvdlmnskeskftfkmnpg
dvitfdnwrllhgrrsyeagteisrhlegayadwdvvmsrlrilrqrve

Timeline for d4c8re2:

• d4c8re2 first appeared in SCOPe 2.06
  
• d4c8re2 appears in SCOPe 2.07