Lineage for d4c31e_ (4c31 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2021327Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2021328Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2021329Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2021369Protein automated matches [310883] (1 species)
    not a true protein
  7. 2021370Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311363] (1 PDB entry)
  8. 2021372Domain d4c31e_: 4c31 E: [307091]
    automated match to d3fwbc_
    protein/RNA complex

Details for d4c31e_

PDB Entry: 4c31 (more details), 3 Å

PDB Description: Nup1:Sac3:Sus1 complex
PDB Compounds: (E:) Protein SUS1

SCOPe Domain Sequences for d4c31e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c31e_ a.301.1.1 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqils
tvepkalemvsdstretvlkqirefleeivdt

SCOPe Domain Coordinates for d4c31e_:

Click to download the PDB-style file with coordinates for d4c31e_.
(The format of our PDB-style files is described here.)

Timeline for d4c31e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4c31b_