Class a: All alpha proteins [46456] (289 folds) |
Fold a.301: Sus1-like [310571] (1 superfamily) 5 helices; articulated hairpin fold |
Superfamily a.301.1: Sus1-like [310603] (1 family) Pfam PF10163 interactions with Sac3, Cdc31 described in PubMed 19328066 |
Family a.301.1.1: Sus1-like [310653] (3 proteins) |
Protein automated matches [310883] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311363] (1 PDB entry) |
Domain d4c31e_: 4c31 E: [307091] automated match to d3fwbc_ protein/RNA complex |
PDB Entry: 4c31 (more details), 3 Å
SCOPe Domain Sequences for d4c31e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c31e_ a.301.1.1 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqils tvepkalemvsdstretvlkqirefleeivdt
Timeline for d4c31e_: