Lineage for d2ezb_2 (2ezb 1-21,145-249)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67590Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 67591Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 67598Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)
  6. 67599Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
  7. 67600Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)
  8. 67606Domain d2ezb_2: 2ezb 1-21,145-249 [30709]
    Other proteins in same PDB: d2ezb_1

Details for d2ezb_2

PDB Entry: 2ezb (more details)

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 14 structures

SCOP Domain Sequences for d2ezb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezb_2 c.8.1.2 (1-21,145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvase

SCOP Domain Coordinates for d2ezb_2:

Click to download the PDB-style file with coordinates for d2ezb_2.
(The format of our PDB-style files is described here.)

Timeline for d2ezb_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ezb_1