SCOPe 2.08: Domain d4bhga2: 4bhg A:96-384

Lineage for d4bhga2 (4bhg A:96-384)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
   automatically mapped to Pfam PF02668

6. Protein automated matches [191275] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311359] (7 PDB entries)

8. Domain d4bhga2: 4bhg A:96-384 [307054]
   Other proteins in same PDB: d4bhga1
   automated match to d3ms5a2
   complexed with 16d, c2t, oga, zn

Details for d4bhga2

PDB Entry: 4bhg, 1.85 Å

PDB Description: three dimensional structure of human gamma-butyrobetaine hydroxylase in complex with 3-(1-ethyl-1,1-dimethylhydrazin-1-ium-2-yl)propanoate

PDB Compounds: (A:) Gamma-butyrobetaine dioxygenase

SCOPe Domain Sequences for d4bhga2:

Sequence; same for both SEQRES and ATOM records:

>d4bhga2 b.82.2.5 (A:96-384) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fskqaraklqrelffpecqywgselqlptldfedvlrydehaykwlstlkkvgivrltga
sdkpgevsklgkrmgflyltfyghtwqvqdkidannvayttgklsfhtdypalhhppgvq
llhcikqtvtggdseivdgfnvcqklkknnpqafqilsstfvdftdigvdycdfsvqskh
kiielddkgqvvrinfnnatrdtifdvpvervqpfyaalkefvdlmnskeskftfkmnpg
dvitfdnwrllhgrrsyeagteisrhlegayadwdvvmsrlrilrqrve

Timeline for d4bhga2:

• d4bhga2 first appeared in SCOPe 2.06
  
• d4bhga2 appears in SCOPe 2.07