Lineage for d4bcla_ (4bcl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068796Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2068797Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2068798Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 protein domains)
  6. 2068799Protein Bacteriochlorophyll A protein [51083] (2 species)
  7. 2068805Species Prosthecochloris aestuarii, strain 2k [TaxId:1102] [51084] (2 PDB entries)
  8. 2068807Domain d4bcla_: 4bcl A: [307040]
    automated match to d3eoja_
    complexed with bcl

Details for d4bcla_

PDB Entry: 4bcl (more details), 1.9 Å

PDB Description: FMO protein from Prosthecochloris aestuarii 2K at Room Temperature
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d4bcla_:

Sequence, based on SEQRES records: (download)

>d4bcla_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Prosthecochloris aestuarii, strain 2k [TaxId: 1102]}
tttahsdyeiileggssswgqvkgrakvnvpaaipllptdcniridakpldaqkgvvrft
tkiesvvdsvkntlnvevdianetkdrriavgegslsvgdfshsfsfegsvvnmyyyrsd
avrrnipnpiymqgrqfhdilmkvpldnndlvdtwegfqqsisggganfgdwirefwfig
pafaaineggqrispivvnssnveggekgpvgvtrwkfshagsgvvdsisrwtelfpveq
lnkpasieggfrsdsqgievkvdgnlpgvsrdaggglrrilnhpliplvhhgmvgkfndf
tvdtqlkivlpkgykiryaapqfrsqnleeyrwsggayarwvehvckggtgqfevlyaq

Sequence, based on observed residues (ATOM records): (download)

>d4bcla_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Prosthecochloris aestuarii, strain 2k [TaxId: 1102]}
tttahsdyeiileggssswgqvkgrakvnvpaaipllptdcniridakpldgvvrfttki
esvvdsvkntlnvevdianetkdrriavgegslsvgdfshsfsfegsvvnmyyyrsdavr
rnipnpiymqgrqfhdilmkvpldnndlvdtwegfqqsiganfgdwirefwfigpafaai
neggqrispivvnssnveggpvgvtrwkfshagsgvvdsisrwtelfpveqlnkpasieg
gfrsdsqgievkvdgnlpgvsrdaggglrrilnhpliplvhhgmvgkfndftvdtqlkiv
lpkgykiryaapqfrsqnleeyrwsggayarwvehvckggtgqfevlyaq

SCOPe Domain Coordinates for d4bcla_:

Click to download the PDB-style file with coordinates for d4bcla_.
(The format of our PDB-style files is described here.)

Timeline for d4bcla_:

  • d4bcla_ is new in SCOPe 2.06-stable